Recombinant Human CCL19 (MIP-3β) (50184PB) – Biotin

Recombinant Human CCL19 (MIP-3β) (50184PB) – Biotin

Product No.: 50184PB

- -
- -
Alternate Names
rHuCCL19, MIP-3beta
Product Type
Recombinant Protein
Expression Host
E. coli Cells
Species
Human
Applications
Migration assay

- -
- -
Select Product Size
- -
- -

Background

CCL19 (also known as Macrophage Inflammatory Protein-3beta, MIP-3b, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.

Protein Details

Format
Biotin
Purity
>97%
Product Concentration
Lot Specific
Endotoxin Level
<0.01 EU/µg as determined by the LAL method
Amino Acid Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
State of Matter
Lyophilized
Predicted Molecular Mass
11.219 kDa
Storage and Stability
12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Country of Origin
USA
Shipping
Next Day 2-8°C
Regulatory Status
Research Use Only
Migration assay

Certificate of Analysis

IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
Disclaimer AlertProducts are for research use only. Not for use in diagnostic or therapeutic procedures.