Recombinant Human CCL28 (MEC) (50183P)
- -
- -
BackgroundCCL28, also known as Mucosae-associated Epithelial Chemokine (MEC), is secreted by gastrointestinal and non-intestinal mucosal cells. It regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. This chemokine is constitutively expressed in the colon, but its levels can be increased by pro-inflammatory cytokines and certain bacterial products implying a role in effector cell recruitment to sites of epithelial injury. CCL28 has also been implicated in the migration of IgA-expressing cells to the mammary gland, salivary gland, intestine and other mucosal tissues. It has also been shown as a potential antimicrobial agent effective against certain pathogens, such as Gram negative and Gram positive bacteria and the fungus Candida albicans. Protein DetailsFormat Purified No Carrier Protein Purity >97% Product Concentration Lot Specific Endotoxin Level <0.01 EU/µg as determined by the LAL method Amino Acid Sequence ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY State of Matter Lyophilized Predicted Molecular Mass 12.031 kDa Storage and Stability 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles. Country of Origin USA Shipping Next Day 2-8°C Regulatory Status Research Use Only Technical ProtocolsMigration assay Certificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.
