Recombinant Human CCL3 (MIP-1α) (50187PB) – Biotin
- -
- -
BackgroundCCL3, also known as Macrophage Inflammatory Protein-1a (MIP-1a), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIV- suppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Protein DetailsFormat Biotin Purity >97% Product Concentration Lot Specific Endotoxin Level <0.01 EU/µg as determined by the LAL method Amino Acid Sequence SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSE
EWVQKYVSDLELSA State of Matter Lyophilized Predicted Molecular Mass 10.135 kDa Storage and Stability 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles. Country of Origin USA Shipping Next Day 2-8°C Regulatory Status Research Use Only Technical ProtocolsMigration assay Certificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.
