Recombinant Human CXCL8 (IL-8) (50190P)
- -
- -
BackgroundThe small cytokine CXCL8 (also known as IL-8) is known to be one of the most potent chemoattractant molecules that, among several other functions, is responsible for guiding neutrophils through the tissue matrix until they reach sites of injury. IL-8 is also a potent promoter of angiogenesis. In target cells, IL-8 binds to two cell surface receptors, CXCR1 and CXCR2, and induces a series of physiological responses required for migration and phagocytosis, such as increase of intracellular Ca2+, exocytosis (e.g. histamine release), and respiratory burst. IL-8 is a member of the CXC chemokine family. The genes encoding this and the other ten members of the CXC chemokine family form a cluster in a region mapped to chromosome 4q. Protein DetailsFormat Purified No Carrier Protein Purity >97% Product Concentration Lot Specific Endotoxin Level <0.01 EU/µg as determined by the LAL method Amino Acid Sequence SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAEN State of Matter Lyophilized Predicted Molecular Mass 8.386 kDa Storage and Stability 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles. Country of Origin USA Shipping Next Day 2-8°C Regulatory Status Research Use Only Technical ProtocolsMigration assay Certificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.