Recombinant Human CXCL8 (IL-8) (50190PB) – Biotin

Recombinant Human CXCL8 (IL-8) (50190PB) – Biotin

Product No.: 50190PB

- -
- -
Alternate Names
rHuCXCL8, IL-8
Product Type
Recombinant Protein
Expression Host
E. coli Cells
Species
Human
Applications
Migration assay

- -
- -
Select Product Size
- -
- -

Background

The small cytokine CXCL8 (also known as IL-8) is known to be one of the most potent chemoattractant molecules that, among several other functions, is responsible for guiding neutrophils through the tissue matrix until they reach sites of injury. IL-8 is also a potent promoter of angiogenesis. In target cells, IL-8 binds to two cell surface receptors, CXCR1 and CXCR2, and induces a series of physiological responses required for migration and phagocytosis, such as increase of intracellular Ca2+, exocytosis (e.g. histamine release), and respiratory burst. IL-8 is a member of the CXC chemokine family. The genes encoding this and the other ten members of the CXC chemokine family form a cluster in a region mapped to chromosome 4q.

Protein Details

Format
Biotin
Purity
>97%
Product Concentration
Lot Specific
Endotoxin Level
<0.01 EU/µg as determined by the LAL method
Amino Acid Sequence
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAEN
State of Matter
Lyophilized
Predicted Molecular Mass
10.803 kDa
Storage and Stability
12 months from date of receipt, -20°C to -70°C, as supplied. 1 month,- 20°C to -70°C, under sterile conditions after reconstitution. Best if used immediately after reconstitution. Avoid multiple freeze-thaw cycles.
Country of Origin
USA
Shipping
Next Day 2-8°C
Regulatory Status
Research Use Only
Migration assay

Certificate of Analysis

IMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein.
Disclaimer AlertProducts are for research use only. Not for use in diagnostic or therapeutic procedures.