Recombinant SARS-CoV-2, RBD Protein (Alpha, B1.1.7, UK Variant)
Recombinant SARS-CoV-2, RBD Protein (Alpha, B1.1.7, UK Variant)
Product No.: S351
- -
- -
Alternate Names 20I/501Y.V1, VOC 202012/01, B.1.1.7, UK Variant, Spike Protein, SARS-CoV-2 Spike Protein, S1 Protein, S1 Subunit, S Protein, Receptor Binding Domain, RBD Product Type Recombinant Protein Expression Host HEK-293 Cells Species SARS-CoV-2 ⋅ Virus Applications ELISA |
- -
- -
BackgroundThis alpha variant of SARS-CoV-2 (also known as 20I/501Y.V1, VOC 202012/01, or B.1.1.7) emerged in the United Kingdom (UK) with a large number of mutations. This variant has been detected in numerous countries, including the United States.1 The RBD mutation is N501Y, A570D. Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of coronavirus disease 2019 (COVID-19), is an enveloped, single-stranded, positive-sense RNA virus that belongs to the Coronaviridae family 2. The SARS-CoV-2 genome, which shares 79.6% identity with SARS-CoV, encodes four essential structural proteins: the spike (S), envelope (E), membrane (M), and nucleocapsid protein (N) 3. The S protein is a transmembrane, homotrimeric, class I fusion glycoprotein that mediates viral attachment, fusion, and entry into host cells 4. Each ~180 kDa monomer contains two functional subunits, S1 (~700 a.a) and S2 (~600 a.a), that mediate viral attachment and membrane fusion, respectively. S1 contains two major domains, the N-terminal (NTD) and C-terminal domains (CTD). The CTD contains the receptor-binding domain (RBD), which binds to the angiotensin-converting enzyme 2 (ACE2) receptor on host cells 4-6. Although both SARS-CoV and SARS-CoV-2 bind the ACE2 receptor, the RBDs only share ~73% amino acid identity, and the SARS-CoV-2 RBD binds with a higher affinity compared to SARS-CoV 4,7. The RBD is dynamic and undergoes hinge-like conformational changes, referred to as the “down” or “up” conformations, which hide or expose the receptor-binding motifs, respectively 8. Following receptor binding, S1 destabilizes, and TMPRSS2 cleaves S2, which undergoes a pre- to post-fusion conformation transition, allowing for membrane fusion 9,10. Protein DetailsFormat Purified No Carrier Protein Purity >95% by SDS Page Product Concentration 0.5 mg/ml Endotoxin Level <0.10 EU per 1 μg of the protein by the LAL method Protein Accession No. Amino Acid Sequence RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIDDTTDAVRDPQTLEILDITPCS State of Matter Sterile Liquid Predicted Molecular Mass The predicted molecular mass is ~33 kDa. Predicted Molecular Mass ~33 kDa Formulation This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. Due to inherent biochemical properties of proteins, certain products may be prone to precipitation over time. Precipitation may be removed by aseptic centrifugation and/or filtration. Storage and Stability This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Next Day Ice Pack NCBI Gene Bank Applications and Recommended Usage ? (Quality Tested by Leinco) ELISA References & Citations1. Center for Disease Control and Prevention. 2020 2. Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020. 3. Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020. 4. Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.02.11.944462. 2020. 5. Walls AC, Park YJ, Tortorici MA, Wall A, McGuire AT, Veesler D. Cell. 181(2):281-292.e6. 2020. 6. Li W, Zhang C, Sui J, et al. EMBO J. 24(8):1634-1643. 2005. 7. Shang, J., Ye, G., Shi, K. et al. Nature 581, 221–224. 2020. 8. Gui M, Song W, Zhou H, et al. Cell Res. 27(1):119-129. 2017. 9. Walls AC, Tortorici MA, Snijder J, et al. Proc Natl Acad Sci U S A. 114(42):11157-11162. 2017. 10.. Hoffmann M, Kleine-Weber H, Schroeder S, et al. Cell. 181(2):271-280.e8. 2020. Technical ProtocolsCertificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Related Products
- -
- -
Prod No. | Description |
---|---|
S851 | |
S151 | |
S251 | |
S451 | |
S951 | |
S952 |
