Recombinant SARS-CoV-2, NTD Protein

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of coronavirus disease 2019 (COVID-19), is an enveloped, single-stranded, positive-sense RNA virus that belongs to the Coronaviridae family ¹. The SARS-CoV-2 genome, which shares 79.6% identity with SARS-CoV, encodes four essential structural proteins: the spike (S), envelope (E), membrane (M), and nucleocapsid protein (N) ². The S protein is a transmembrane, homotrimeric, class I fusion glycoprotein that mediates viral attachment, fusion, and entry into host cells ³. Each ~180 kDa monomer contains two functional subunits, S1 (~700 a.a) and S2 (~600 a.a), that mediate viral attachment and membrane fusion, respectively. S1 contains two major domains, the N-terminal (NTD) and C-terminal domains (CTD). In both SARS-CoV and SARS-CoV-2, the CTD contains the receptor-binding domain (RBD), which binds to the angiotensin-converting enzyme 2 (ACE2) receptor on host cells^3-5. The NTD of SARS-CoV-2 does not bind to ACE2⁶, and the function of NTD in SARS-CoV-2 infection is not well understood. In other CoVs, the NTD may promote attachment by binding to sugar moieties⁷ and might play a role in the conformational change of S2 required for membrane fusion⁸. While most neutralizing antibodies target the RBD domain and block receptor binding, potent neutralizing antibodies targeting NTD were isolated from convalescent COVID19 patients⁹, identifying the NTD as an attractive candidate for vaccines and therapeutics. In addition, the NTD is a promising antigen for diagnostic tests, as there is only 53.5% homology between the NTD of SARS-CoV-2 and SARS-CoV¹⁰.

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS

Sterile Liquid

The predicted molecular mass is ~36 kDa.

~36 kDa

This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. Due to inherent biochemical properties of proteins, certain products may be prone to precipitation over time. Precipitation may be removed by aseptic centrifugation and/or filtration.

This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles.

Next Day

1. Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020.
2. Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020.
3. Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.
4. Walls AC, Park YJ, Tortorici MA, et al. Cell. 181(2):281-292.e6. 2020.
5. Li W, Zhang C, Sui J, et al. EMBO J. 24(8):1634-1643. 2020.
6. Wang Q, Zhang Y, Wu L, et al. Cell. 181(4):894-904.e9. 2020.
7. Park, Y., Walls, A.C., Wang, Z. et al. Nat Struct Mol Biol 26, 1151–1157. 2019.
8. Zhou, H., Chen, Y., Zhang, S. et al. Nat Commun 10, 3068. 2019.
9. Chi X, Yan R, Zhang J, et al. Science. eabc6952. 2020.
10. Ou, X., Liu, Y., Lei, X. et al. Nat Commun 11, 1620. 2020.