Recombinant SARS-CoV-2, S1-mFc Protein
- -
- -
BackgroundThis recombinant SARS-CoV-2 S1 protein is with the mFc tag. The SARS-CoV-2 Spike (S) Protein consists of the S1 and S2 domains. The S1 subunit contains the N-terminal domain (NTD) and receptor-binding domain (RBD). The S1 subunit recognizes and binds to angiotensin-converting enzyme 2 (ACE2) receptors on target cells through the RBD portion, and subsequent conformational changes in S2 allow for fusion between the viral envelope and host cell membrane. SARS-CoV-2 is closely related to the SARS virus, which was first identified in 2002-20031. Both SARS-CoV and SARS-CoV-2 utilize the ACE2 cell receptor to gain entry into cells, with SARS-CoV-2 binding with higher affinity2. Vaccine and therapeutic development are targeting portions of the spike protein, including the S1 portion3.
Protein DetailsFormat Purified No Carrier Protein Purity >95% by SDS Page Product Concentration 0.5 mg/ml Endotoxin Level <0.10 EU per 1 μg of the protein by the LAL method Protein Accession No. Amino Acid Sequence VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSG
TNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKV
CEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQG
NFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLAL
HRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKC
TLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN
CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKI
ADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQA
GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKST
NLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITP
CSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQT
RAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGSASGGGSGGGSKPCICTVPE
VSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREE
QFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIP
PPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVY
SKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
State of Matter Sterile Liquid Predicted Molecular Mass The predicted molecular mass is ~103 kDa. Predicted Molecular Mass ~77 kDa Formulation This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. Due to inherent biochemical properties of proteins, certain products may be prone to precipitation over time. Precipitation may be removed by aseptic centrifugation and/or filtration. Storage and Stability This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles. Country of Origin USA Shipping Next Day Ice Pack NCBI Gene Bank Applications and Recommended Usage ? (Quality Tested by Leinco) ELISA References & Citations1. Quinlan et al. bioRxiv: 2020. 2. Wrapp et al. Science: 2020. 3. Tai et al. Nature: 2020. Technical ProtocolsCertificate of AnalysisIMPORTANT Use lot specific datasheet for all technical information pertaining to this recombinant protein. |
Related Products
- -
- -
Prod No. | Description |
---|---|
A314 | |
S540 | |
A313 | |
S538 | |
A315 | |
A316 | |
S536 | |
S537 | |
S539 | |
S541 | |
S542 | |
S543 | |
S544 |
Products are for research use only. Not for use in diagnostic or therapeutic procedures.